McDonnell Genome Institute

Washington University

Transcript

lnc-SUMF1-12:4

Chromosome

chr3

Gene Name

lnc-SUMF1-12

Start

5010336

CPC Label

coding

End

5027053

Cancer

OV

Strand

-

Peptide

LDMSELEIK

Modified Peptide

n[145]LDMSELEIK

Peptide Length

9

ORF Length

59

Open Reading Frame (ORF)

LDMSELEIKRNWHSKGRVRLLPDAGLVVVGVPSADARVGLHNIVLLGEELAEGEQTENL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.798023

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8891

PhyloCSF Frame 3

0

CNTI Score

-0.324273734