McDonnell Genome Institute

Washington University

Transcript

lnc-SULT4A1-4:1

Chromosome

chr22

Gene Name

lnc-SULT4A1-4

Start

43712009

CPC Label

noncoding

End

43714118

Cancer

EOGC

Strand

-

Peptide

SGVVSWVVENMPLR

Modified Peptide

n[145]SGVVSWVVENMPLR

Peptide Length

14

ORF Length

131

Open Reading Frame (ORF)

LQNHLFFILFVLKMRFTHIMSIAVLSFSLLYSFPYLNILQVIHSPMDGHLDCFLFYANPNSATISGCKLSFWSTDAKVSPEITPRSGVVSWVVENMPLRLNGQYPIACHHIDLHSHQKHVSTPAVPRAPNT

Conservation Score

0.054

PhyloCSF Frame 1

-3.761

No. of Spectra

8

CPC Coding Probability

0.276527

PhyloCSF Frame 2 

-3.794

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

-3.922

CNTI Score

-0.377382009