McDonnell Genome Institute

Washington University

Transcript

lnc-SULT1C2-3:1

Chromosome

chr2

Gene Name

lnc-SULT1C2-3

Start

108276811

CPC Label

noncoding

End

108277942

Cancer

OV

Strand

+

Peptide

CHLPAVPIVWVAK

Modified Peptide

n[145]CHLPAVPIVWVAK

Peptide Length

13

ORF Length

89

Open Reading Frame (ORF)

MTPTPPTQVTSAYEPKCHLPAVPIVWVAKSVLLEAVRKGVRLHNVEEQGVKRAHHEDIENDVATVLSCHTAVESSDSENVSKFDEVDWL

Conservation Score

1

PhyloCSF Frame 1

-4.57

No. of Spectra

20

CPC Coding Probability

0.298036

PhyloCSF Frame 2 

-4.732

CNTI Index

noncoding

Max Probability

0.979

PhyloCSF Frame 3

-4.432

CNTI Score

-0.347963428