McDonnell Genome Institute

Washington University

Transcript

lnc-SULT1C2-1:1

Chromosome

chr2

Gene Name

lnc-SULT1C2-1

Start

108322237

CPC Label

noncoding

End

108353799

Cancer

OV

Strand

+

Peptide

AGTTWTQEIVDLIQNDGDIEK

Modified Peptide

n[145]AGTTWTQEIVDLIQNDGDIEK

Peptide Length

21

ORF Length

124

Open Reading Frame (ORF)

LLPPEEFSQVNGIILQKKMCDFWDKIWNFQAKPDDLLIASYPKAGTTWTQEIVDLIQNDGDIEKSRRASIQLQHPFLEWIRMTHCGIDQANTMPSPRTLKTHLPVQLLPPSFWEENCKCPRGRI

Conservation Score

1

PhyloCSF Frame 1

-1.707

No. of Spectra

1

CPC Coding Probability

0.258669

PhyloCSF Frame 2 

-2.739

CNTI Index

noncoding

Max Probability

0.7201

PhyloCSF Frame 3

13.254

CNTI Score

-0.338457932