McDonnell Genome Institute

Washington University

Transcript

lnc-SULT1A4-2:1

Chromosome

chr16

Gene Name

lnc-SULT1A4-2

Start

29475063

CPC Label

noncoding

End

29475355

Cancer

HCC

Strand

+

Peptide

DSLSLFQLTNFSLVPVQWR

Modified Peptide

n[272]DSLSLFQLTNFSLVPVQWR

Peptide Length

19

ORF Length

67

Open Reading Frame (ORF)

MDSLSLFQLTNFSLVPVQWRTAYAGVCGFLWATFICFSQQSGDGTFKSAFTILYTKGTSATEGSPEK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0836579

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7662

PhyloCSF Frame 3

0

CNTI Score

-0.42298069