McDonnell Genome Institute

Washington University

Transcript

lnc-SULT1A1-1:1

Chromosome

chr16

Gene Name

lnc-SULT1A1-1

Start

28700293

CPC Label

noncoding

End

28701540

Cancer

OSCC

Strand

-

Peptide

LEPVEVTSSPLRNSK

Modified Peptide

n[145]LEPVEVTSSPLRNSK

Peptide Length

15

ORF Length

80

Open Reading Frame (ORF)

LEPVEVTSSPLRNSKRASMRRTRKCSKMDPTKAKFPMQQCIDAGLRVPNSEVSEAKEGEEECSGTGCWKLFPRQAGMSVR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.299002

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9959

PhyloCSF Frame 3

0

CNTI Score

0.733454737