McDonnell Genome Institute

Washington University

Transcript

lnc-SULF2-4:1

Chromosome

chr20

Gene Name

lnc-SULF2-4

Start

48120850

CPC Label

noncoding

End

48126782

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

EVVVLLF

Modified Peptide

n[145]EVVVLLF

Peptide Length

7

ORF Length

52

Open Reading Frame (ORF)

LKAVELEIPGRAGAAVYICGSWSWSPSGEPGPAIHVLGSWSWKPREVVVLLF

Conservation Score

0.922

PhyloCSF Frame 1

0

No. of Spectra

21

CPC Coding Probability

0.0990167

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9949

PhyloCSF Frame 3

0

CNTI Score

-0.312980414