McDonnell Genome Institute

Washington University

Transcript

lnc-SULF2-2:2

Chromosome

chr20

Gene Name

lnc-SULF2-2

Start

47894371

CPC Label

noncoding

End

47899530

Cancer

OV

Strand

-

Peptide

LLLPGSAAPRPSNQNK

Modified Peptide

n[145]LLLPGSAAPRPSNQNK

Peptide Length

16

ORF Length

209

Open Reading Frame (ORF)

LLLPGSAAPRPSNQNKTSPPWVASFLTLELKQQCSSLGQKLHDPETRTRPLLPGSPVSGPLNYNKMAPPWVCSSTTLELEQDLSSPSCQLPDPRTTTTLLHPGSVAPRPSDRIKTSPPWVASFRTLKLQQNCSSLGRQLHDPHNRTRPLLPGSPASGPLNYNKIAPPWVGSSTTLKLQQDFSSPSCQLPDPRITTTLPLPGSAAPRPSD

Conservation Score

0.019

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.352299

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9636

PhyloCSF Frame 3

0

CNTI Score

-0.283370544