McDonnell Genome Institute

Washington University

Transcript

lnc-SULF1-3:12

Chromosome

chr8

Gene Name

lnc-SULF1-3

Start

69834121

CPC Label

coding

End

69856559

Cancer

OV

Strand

+

Peptide

LDPFLTSSTK

Modified Peptide

n[145]LDPFLTSSTK

Peptide Length

10

ORF Length

325

Open Reading Frame (ORF)

LEQNRALRNNTTHLQPLIFDKLDKNKQWGKDSLFNKWCWENWLAICRKLKLDPFLTSSTKIKSRWIKDLYVRLKTIKTLEENLGNTIQDIGMGKDFMSKTPKAMATKAKIDKQDLNKLKSFCTAKETTIRVNRQPTEWEKIFAIYSSYKGLISRIYNELKQTHKEKTNNPIKKWVKDMNRHFSKEDIYAANRHMKKCSSSLAIREMQIKTTMRYHLTPVRIAIIKKSGNNRCWRGCGEIGMLLHCWWDYKLVQPLWKSVWPFLRDLELEIPFDPAIPLLGIYPKDYKSCCYKDTCTHMFIAALFTITKTWNQPKCPSMIDWIKKM

Conservation Score

0.258

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.727846

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3769

PhyloCSF Frame 3

0

CNTI Score

-0.318977558