McDonnell Genome Institute

Washington University

Transcript

lnc-SUGP1-3:1

Chromosome

chr19

Gene Name

lnc-SUGP1-3

Start

19366776

CPC Label

noncoding

End

19385315

Cancer

LUAD

Strand

-

Peptide

KMRGSCAPCAFLSSI

Modified Peptide

KM[147]RGSCAPCAFLSSI

Peptide Length

15

ORF Length

54

Open Reading Frame (ORF)

LRQENRLNLGGRLQCAEIHHCTPAWMTVRLRLKKKERKRKMRGSCAPCAFLSSI

Conservation Score

0.993

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0244383

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0636

PhyloCSF Frame 3

0

CNTI Score

-0.365516255