McDonnell Genome Institute

Washington University

Transcript

lnc-SUCLG1-4:1

Chromosome

chr2

Gene Name

lnc-SUCLG1-4

Start

84039884

CPC Label

noncoding

End

84040720

Cancer

CCRC

Strand

-

Peptide

SHIPTAFR

Modified Peptide

n[230]SHIPTAFR

Peptide Length

8

ORF Length

71

Open Reading Frame (ORF)

LPERLLTQELWDRLKQLGAPHAASSPTLPSHGHNPEQSEWLLRMLSCTPPPRSHIPTAFRAPRWLTEVEVS

Conservation Score

0.411

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.108087

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9944

PhyloCSF Frame 3

0

CNTI Score

-0.329666483