McDonnell Genome Institute

Washington University

Transcript

lnc-SUCLA2-9:1

Chromosome

chr13

Gene Name

lnc-SUCLA2-9

Start

47474975

CPC Label

noncoding

End

47476090

Cancer

EOGC

Strand

-

Peptide

EGITPHLAR

Modified Peptide

n[145]EGITPHLAR

Peptide Length

9

ORF Length

33

Open Reading Frame (ORF)

LLLSILMREGITPHLARQCTVNSQAVFLRVQVT

Conservation Score

1

PhyloCSF Frame 1

-3.704

No. of Spectra

32

CPC Coding Probability

0.0155128

PhyloCSF Frame 2 

-4.549

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

-4.104

CNTI Score

-0.425690708