McDonnell Genome Institute

Washington University

Transcript

lnc-SUCLA2-12:1

Chromosome

chr13

Gene Name

lnc-SUCLA2-12

Start

48041750

CPC Label

noncoding

End

48042184

Cancer

OV

Strand

-

Peptide

DGINSPAQVR

Modified Peptide

n[145]DGINSPAQVR

Peptide Length

10

ORF Length

40

Open Reading Frame (ORF)

MDGINSPAQVRKLSKTDKIFSLKLLPETKLNNNNKTYCVH

Conservation Score

0.771

PhyloCSF Frame 1

-5.918

No. of Spectra

13

CPC Coding Probability

0.0841382

PhyloCSF Frame 2 

-4.949

CNTI Index

noncoding

Max Probability

0.9873

PhyloCSF Frame 3

-5.232

CNTI Score

-0.436006226