McDonnell Genome Institute

Washington University

Transcript

lnc-STYXL1-5:1

Chromosome

chr7

Gene Name

lnc-STYXL1-5

Start

76117724

CPC Label

noncoding

End

76132187

Cancer

EOGC

Strand

-

Peptide

EIQEDWELAER

Modified Peptide

n[145]EIQEDWELAER

Peptide Length

11

ORF Length

105

Open Reading Frame (ORF)

LCKEGCGYYGNPAWQGFCSKCWREEYHKARQKEIQEDWELAERLALSPQLEYSGAVSTHCILCFLGSSDPPASASQVARTTPVGGRGLCQQSEQPRGPIPHILQV

Conservation Score

1

PhyloCSF Frame 1

7.397

No. of Spectra

11

CPC Coding Probability

0.0881778

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9864

PhyloCSF Frame 3

7.191

CNTI Score

-0.331612942