McDonnell Genome Institute

Washington University

Transcript

lnc-STYXL1-4:1

Chromosome

chr7

Gene Name

lnc-STYXL1-4

Start

76090430

CPC Label

coding

End

76108779

Cancer

BRCA-Luminal A

Strand

-

Peptide

LAISVPPER

Modified Peptide

n[145]LAISVPPER

Peptide Length

9

ORF Length

35

Open Reading Frame (ORF)

LAISVPPERVEKIMDQIEKYIMTHLCKYAFCPEPQ

Conservation Score

1

PhyloCSF Frame 1

4.522

No. of Spectra

1

CPC Coding Probability

0.827036

PhyloCSF Frame 2 

-5.074

CNTI Index

noncoding

Max Probability

0.0875

PhyloCSF Frame 3

-4.727

CNTI Score

-0.354169434