McDonnell Genome Institute

Washington University

Transcript

lnc-STYXL1-3:1

Chromosome

chr7

Gene Name

lnc-STYXL1-3

Start

76071468

CPC Label

noncoding

End

76074963

Cancer

OV

Strand

-

Peptide

WPSPAVFLPASQRPRQAHR

Modified Peptide

n[145]WPSPAVFLPASQRPRQAHR

Peptide Length

19

ORF Length

264

Open Reading Frame (ORF)

LQAQVGKPPPRPGGCLPAYSPGPALSRGCASMPSPSLQTAASDSARAQIPAAFVRPKPPPAQLSRPTCGLAVASPGPDLASRWPSPAVFLPASQRPRQAHRMPLTGLWRSSSSLTVASPGPAPARPDGVSRPRVSQVGPSRAQLLPPGRWPVRAQSVLKSASPGPAPACRRPLDLRHGLCLLTVDPHQAQLLPQHGRLRPGSCSACGQPPRARLSPLAILSRPRSVSSQPLQAQLSLPAAPAGPAPASQQPRSAQLLPSSWQPL

Conservation Score

0.286

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.296384

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6062

PhyloCSF Frame 3

0

CNTI Score

-0.215184316