McDonnell Genome Institute

Washington University

Transcript

lnc-STYXL1-1:1

Chromosome

chr7

Gene Name

lnc-STYXL1-1

Start

76006794

CPC Label

noncoding

End

76279258

Cancer

OV

Strand

-

Peptide

ALGVSYR

Modified Peptide

n[145]ALGVSYR

Peptide Length

7

ORF Length

43

Open Reading Frame (ORF)

MALGVSYRGQGAVQAFPCRAGAELNMEVDPGGQPHWWKGTDGS

Conservation Score

0.04

PhyloCSF Frame 1

-6.656

No. of Spectra

3

CPC Coding Probability

0.0239376

PhyloCSF Frame 2 

-5.05

CNTI Index

noncoding

Max Probability

0.6975

PhyloCSF Frame 3

-4.529

CNTI Score

-0.309213259