McDonnell Genome Institute

Washington University

Transcript

lnc-STYX-5:9

Chromosome

chr14

Gene Name

lnc-STYX-5

Start

53217654

CPC Label

noncoding

End

53328294

Cancer

HCC

Strand

+

Peptide

ILEEESSMVR

Modified Peptide

n[230]ILEEESSM[147]VR

Peptide Length

10

ORF Length

61

Open Reading Frame (ORF)

LALGSRLWVAKNGHTHTHSLSLSSSLSVPLPLSIIWSHLGKLMKILEEESSMVRLSSVKVT

Conservation Score

0.762

PhyloCSF Frame 1

0

No. of Spectra

26

CPC Coding Probability

0.410283

PhyloCSF Frame 2 

-3.594

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

0

CNTI Score

-0.28472208