McDonnell Genome Institute

Washington University

Transcript

lnc-STYX-13:2

Chromosome

chr14

Gene Name

lnc-STYX-13

Start

52951431

CPC Label

noncoding

End

52955050

Cancer

OV

Strand

+

Peptide

ETVGLFHGEISGAR

Modified Peptide

n[145]ETVGLFHGEISGAR

Peptide Length

14

ORF Length

77

Open Reading Frame (ORF)

MDRIFRGFLWCFLNSSKENLSSLRAEISNYFHCPQIHNSLVQRKWKTCWCQTNTNVKETVGLFHGEISGARYSGSCL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0647488

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.28

PhyloCSF Frame 3

0

CNTI Score

-0.345298879