McDonnell Genome Institute

Washington University

Transcript

lnc-STXBP6-2:1

Chromosome

chr14

Gene Name

lnc-STXBP6-2

Start

26592746

CPC Label

noncoding

End

26594517

Cancer

CCRC

Strand

-

Peptide

FSVSLTQMYVR

Modified Peptide

n[230]FSVSLTQM[147]YVR

Peptide Length

11

ORF Length

40

Open Reading Frame (ORF)

LTTSLQNNFKIPVFFNIASERFSVSLTQMYVRDTYLVHLR

Conservation Score

1

PhyloCSF Frame 1

-3.359

No. of Spectra

2

CPC Coding Probability

0.055973

PhyloCSF Frame 2 

-4.449

CNTI Index

noncoding

Max Probability

0.994

PhyloCSF Frame 3

-4.275

CNTI Score

-0.449482091