McDonnell Genome Institute

Washington University

Transcript

lnc-STXBP4-6:2

Chromosome

chr17

Gene Name

lnc-STXBP4-6

Start

55283495

CPC Label

noncoding

End

55288930

Cancer

OV

Strand

+

Peptide

EAVIPTPVERALR

Modified Peptide

n[145]EAVIPTPVERALR

Peptide Length

13

ORF Length

36

Open Reading Frame (ORF)

LIQLLGHETGIARWREAVIPTPVERALRFCAVDLLS

Conservation Score

1

PhyloCSF Frame 1

-2.835

No. of Spectra

1

CPC Coding Probability

0.0137933

PhyloCSF Frame 2 

-4.915

CNTI Index

noncoding

Max Probability

0.1528

PhyloCSF Frame 3

-4.406

CNTI Score

-0.403486128