McDonnell Genome Institute

Washington University

Transcript

lnc-STX8-4:1

Chromosome

chr17

Gene Name

lnc-STX8-4

Start

9238248

CPC Label

noncoding

End

9241855

Cancer

OV

Strand

-

Peptide

SLASHAVR

Modified Peptide

n[145]SLASHAVR

Peptide Length

8

ORF Length

101

Open Reading Frame (ORF)

LIVDPHLLTTGPRSLASHAVRVPPSTAVGTSHLLALSRPTLSRKPTVFSLVEGLPQMEHASESPGRLVKIHCWAPPQSFRLNRSGLGHGVDLSPPETGAAA

Conservation Score

0.042

PhyloCSF Frame 1

-5.138

No. of Spectra

31

CPC Coding Probability

0.152138

PhyloCSF Frame 2 

-2.11

CNTI Index

noncoding

Max Probability

0.94

PhyloCSF Frame 3

-3.336

CNTI Score

-0.258571986