McDonnell Genome Institute

Washington University

Transcript

lnc-STX8-1:7

Chromosome

chr17

Gene Name

lnc-STX8-1

Start

9605257

CPC Label

noncoding

End

9645383

Cancer

HCC

Strand

-

Peptide

VSPCWPGWSQTPDPR

Modified Peptide

VSPCWPGWSQTPDPR

Peptide Length

15

ORF Length

69

Open Reading Frame (ORF)

LSVTQAGVEWHDLSSLQPPPPRLKQFSCLSLPSSWDYRRAPPRPANFCVFSRHRVSPCWPGWSQTPDPR

Conservation Score

0.129

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.197333

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6997

PhyloCSF Frame 3

0

CNTI Score

-0.341395053