McDonnell Genome Institute

Washington University

Transcript

lnc-STX8-1:2

Chromosome

chr17

Gene Name

lnc-STX8-1

Start

9634319

CPC Label

noncoding

End

9646032

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LFNFDHLK

Modified Peptide

n[145]LFNFDHLK

Peptide Length

8

ORF Length

39

Open Reading Frame (ORF)

LFNFDHLKAMVPNSTESNTYFISQIFPNTCVLSWSEIHR

Conservation Score

0.995

PhyloCSF Frame 1

-4.778

No. of Spectra

4

CPC Coding Probability

0.252436

PhyloCSF Frame 2 

-4.387

CNTI Index

noncoding

Max Probability

0.9992

PhyloCSF Frame 3

-6.395

CNTI Score

-0.249533843