McDonnell Genome Institute

Washington University

Transcript

lnc-STX7-1:1

Chromosome

chr6

Gene Name

lnc-STX7-1

Start

132518829

CPC Label

noncoding

End

132519295

Cancer

OV

Strand

-

Peptide

IIDVHIEHIK

Modified Peptide

n[145]IIDVHIEHIK

Peptide Length

10

ORF Length

75

Open Reading Frame (ORF)

MPHNYHHGKTGRVYNVTQHTVGTVVNKQVNGMILAKIIDVHIEHIKYSKCRDSFLKHVKENDQKRISRRKSPEFN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.12144

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9689

PhyloCSF Frame 3

0

CNTI Score

-0.364330292