McDonnell Genome Institute

Washington University

Transcript

lnc-STX6-6:7

Chromosome

chr1

Gene Name

lnc-STX6-6

Start

181093887

CPC Label

noncoding

End

181105215

Cancer

HCC

Strand

-

Peptide

EGAVVAGIGK

Modified Peptide

n[230]EGAVVAGIGK

Peptide Length

10

ORF Length

36

Open Reading Frame (ORF)

LYSSGRQQLLERDFILKPPFPLREGAVVAGIGKNCV

Conservation Score

1

PhyloCSF Frame 1

-3.497

No. of Spectra

12

CPC Coding Probability

0.423255

PhyloCSF Frame 2 

-4.689

CNTI Index

noncoding

Max Probability

0.7038

PhyloCSF Frame 3

-5.168

CNTI Score

-0.345439546