McDonnell Genome Institute

Washington University

Transcript

lnc-STX6-6:3

Chromosome

chr1

Gene Name

lnc-STX6-6

Start

181093887

CPC Label

noncoding

End

181105304

Cancer

BRCA-Luminal B

Strand

-

Peptide

SLHQVEKSAR

Modified Peptide

n[145]SLHQVEKSAR

Peptide Length

10

ORF Length

52

Open Reading Frame (ORF)

LVKQRNVNKSLHQVEKSARIHWPSRMYTPLPTPCYYDGIGGLVRHSERMISS

Conservation Score

0.998

PhyloCSF Frame 1

-4.241

No. of Spectra

4

CPC Coding Probability

0.0510099

PhyloCSF Frame 2 

-4.558

CNTI Index

noncoding

Max Probability

0.9953

PhyloCSF Frame 3

-3.052

CNTI Score

-0.326368014