McDonnell Genome Institute

Washington University

Transcript

lnc-STX4-2:1

Chromosome

chr16

Gene Name

lnc-STX4-2

Start

31028082

CPC Label

noncoding

End

31028836

Cancer

PRAD

Strand

+

Peptide

LPGSGDSPDSASQVAGITGMCHHAR

Modified Peptide

LPGSGDSPDSASQVAGITGM[147]CHHAR

Peptide Length

25

ORF Length

47

Open Reading Frame (ORF)

LLPPAYNGAVLAHCNFRLPGSGDSPDSASQVAGITGMCHHARLILYF

Conservation Score

0.058

PhyloCSF Frame 1

0

No. of Spectra

19

CPC Coding Probability

0.0564828

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8888

PhyloCSF Frame 3

0

CNTI Score

-0.384451062