McDonnell Genome Institute

Washington University

Transcript

lnc-STX4-1:2

Chromosome

chr16

Gene Name

lnc-STX4-1

Start

31041052

CPC Label

noncoding

End

31042955

Cancer

HCC

Strand

+

Peptide

SPLTANFASR

Modified Peptide

n[230]SPLTANFASR

Peptide Length

10

ORF Length

33

Open Reading Frame (ORF)

LLYRPDWSAVVRSPLTANFASRVHAILLPQAPE

Conservation Score

0.075

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.0765744

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

0

CNTI Score

-0.325130397