McDonnell Genome Institute

Washington University

Transcript

lnc-STX2-8:1

Chromosome

chr12

Gene Name

lnc-STX2-8

Start

130874806

CPC Label

noncoding

End

130877338

Cancer

OV

Strand

-

Peptide

AHTVLPK

Modified Peptide

n[145]AHTVLPK

Peptide Length

7

ORF Length

70

Open Reading Frame (ORF)

LTLGSSFILTGHHPHPGEQLSEQPRRRDGKTLTLQIKTARNKQAKPNNLNSKVATIPLSRAHTVLPKLGP

Conservation Score

1

PhyloCSF Frame 1

0.427

No. of Spectra

3

CPC Coding Probability

0.0189056

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.368

PhyloCSF Frame 3

10.151

CNTI Score

-0.365184462