McDonnell Genome Institute

Washington University

Transcript

lnc-STX2-4:1

Chromosome

chr12

Gene Name

lnc-STX2-4

Start

130419534

CPC Label

noncoding

End

130421019

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

RGALFFR

Modified Peptide

n[145]RGALFFR

Peptide Length

7

ORF Length

63

Open Reading Frame (ORF)

LNISSVFSHFLLFWLLSLQSEESPACFLCVQGGKIKTLVTLLTKLCPLKRGALFFRFPCNKKN

Conservation Score

0.999

PhyloCSF Frame 1

-4.884

No. of Spectra

6

CPC Coding Probability

0.00689331

PhyloCSF Frame 2 

-3.856

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

-4.708

CNTI Score

-0.467420758