McDonnell Genome Institute

Washington University

Transcript

lnc-STX2-1:1

Chromosome

chr12

Gene Name

lnc-STX2-1

Start

130769819

CPC Label

noncoding

End

130775778

Cancer

EOGC

Strand

-

Peptide

ESEPILK

Modified Peptide

n[145]ESEPILK

Peptide Length

7

ORF Length

41

Open Reading Frame (ORF)

LTRAFLLHPHVAESGRARESEPILKTPDYRGTNPFMWVELP

Conservation Score

0.071

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.123276

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.410269981