McDonnell Genome Institute

Washington University

Transcript

lnc-STX17-3:1

Chromosome

chr9

Gene Name

lnc-STX17-3

Start

100102558

CPC Label

noncoding

End

100102837

Cancer

LUAD

Strand

+

Peptide

LTQEFQAVVR

Modified Peptide

n[230]LTQEFQAVVR

Peptide Length

10

ORF Length

38

Open Reading Frame (ORF)

LKSQLFRWLRREDRLTQEFQAVVRYAIQVSTLSLASIW

Conservation Score

0.061

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0306078

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9854

PhyloCSF Frame 3

0

CNTI Score

-0.400179122