McDonnell Genome Institute

Washington University

Transcript

lnc-STX10-2:1

Chromosome

chr19

Gene Name

lnc-STX10-2

Start

13153095

CPC Label

noncoding

End

13154193

Cancer

EOGC

Strand

-

Peptide

MEGGGLASGLRPRADGSTRALGSGSAAR

Modified Peptide

n[145]M[147]EGGGLASGLRPRADGSTRALGSGSAAR

Peptide Length

28

ORF Length

170

Open Reading Frame (ORF)

MEGGGLASGLRPRADGSTRALGSGSAARGPQKATTARTSTLSMLSAGRQAGFASHAGGAVGGAAGLQFRRPEKRLCRTRARLGKAPSACAGGGCRRSATSDDAPSSSSFSSRRAFLLGTSPASPPSLRVMMRCASFCTSMATRRRQRRGLPGGTEQAAGALRTTGSLTPL

Conservation Score

1

PhyloCSF Frame 1

-0.981

No. of Spectra

1

CPC Coding Probability

0.0462652

PhyloCSF Frame 2 

14.808

CNTI Index

noncoding

Max Probability

0.052

PhyloCSF Frame 3

1.527

CNTI Score

-0.287230084