McDonnell Genome Institute

Washington University

Transcript

lnc-STT3B-2:1

Chromosome

chr3

Gene Name

lnc-STT3B-2

Start

31452831

CPC Label

noncoding

End

31455894

Cancer

CCRC

Strand

+

Peptide

ESEFDDDEPK

Modified Peptide

ESEFDDDEPK

Peptide Length

10

ORF Length

75

Open Reading Frame (ORF)

LGDGKMKSDSFAPKTDSEKPFRGSQSLKRHKLRSDFEKKMADFHKEEMDDQDKDKAKGRKESEFDDDEPKICLKS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.142453

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.684

PhyloCSF Frame 3

0

CNTI Score

-0.288121187