McDonnell Genome Institute

Washington University

Transcript

lnc-STRADA-3:1

Chromosome

chr17

Gene Name

lnc-STRADA-3

Start

63610771

CPC Label

noncoding

End

63611184

Cancer

EOGC

Strand

-

Peptide

LQQLWVQEVVDSMVK

Modified Peptide

n[145]LQQLWVQEVVDSMVK

Peptide Length

15

ORF Length

45

Open Reading Frame (ORF)

LQQLWVQEVVDSMVKSLERENIWKMQGLMFRCSTSCCEDSQASMQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0696301

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.5313

PhyloCSF Frame 3

0

CNTI Score

0.673737908