McDonnell Genome Institute

Washington University

Transcript

lnc-STPG2-3:2

Chromosome

chr4

Gene Name

lnc-STPG2-3

Start

98256533

CPC Label

noncoding

End

98261155

Cancer

OV

Strand

-

Peptide

LHHCTPAWATEQDPVSK

Modified Peptide

n[145]LHHCTPAWATEQDPVSK

Peptide Length

17

ORF Length

124

Open Reading Frame (ORF)

LRQENRLNPGGGGCSELRLHHCTPAWATEQDPVSKKIKIKKKNPGGVHNSTHNTPMQTPPSGPLTAPTSAMLHINFITPPEDQPGPLHCCSSFFVHLSLTLINLFQIVKLTCFIFPTSLSNYIL

Conservation Score

0.986

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0971902

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6176

PhyloCSF Frame 3

0

CNTI Score

0.680744305