McDonnell Genome Institute

Washington University

Transcript

lnc-STPG2-3:1

Chromosome

chr4

Gene Name

lnc-STPG2-3

Start

98256533

CPC Label

noncoding

End

98261155

Cancer

CCRC

Strand

-

Peptide

MPVIPALWEAEAGGLR

Modified Peptide

n[230]MPVIPALWEAEAGGLR

Peptide Length

16

ORF Length

33

Open Reading Frame (ORF)

MPVIPALWEAEAGGLRGQEIETILANMVKPRLY

Conservation Score

0.011

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0948156

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0742

PhyloCSF Frame 3

0

CNTI Score

-0.29224901