McDonnell Genome Institute

Washington University

Transcript

lnc-STPG1-2:1

Chromosome

chr1

Gene Name

lnc-STPG1-2

Start

24411189

CPC Label

noncoding

End

24428500

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

KSWEASVPGSGWTPK

Modified Peptide

n[145]KSWEASVPGSGWTPK

Peptide Length

15

ORF Length

97

Open Reading Frame (ORF)

MSSAWDARGDPPASGCLRNSRAELGGAPRAGRSHHGSCPCVGACPRCFHPKSGDNWGLPAPPSSCQGRGRPTLLAQAPRVRKSWEASVPGSGWTPKT

Conservation Score

0.171

PhyloCSF Frame 1

-4.971

No. of Spectra

5

CPC Coding Probability

0.156289

PhyloCSF Frame 2 

-4.49

CNTI Index

coding

Max Probability

0.7784

PhyloCSF Frame 3

-2.73

CNTI Score

0.671020504