McDonnell Genome Institute

Washington University

Transcript

lnc-STOX2-1:2

Chromosome

chr4

Gene Name

lnc-STOX2-1

Start

183765909

CPC Label

noncoding

End

183767300

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

FFLNSLVLLR

Modified Peptide

n[145]FFLNSLVLLR

Peptide Length

10

ORF Length

66

Open Reading Frame (ORF)

MLECQPRLRFFLNSLVLLRAPMSAVSWRARPCEGTASRPGHGWWPGRRKCERVKRERRHERGTLLG

Conservation Score

0.12

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0851908

PhyloCSF Frame 2 

-5.245

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

-4.93

CNTI Score

-0.346701783