McDonnell Genome Institute

Washington University

Transcript

lnc-STON2-2:1

Chromosome

chr14

Gene Name

lnc-STON2-2

Start

81259564

CPC Label

coding

End

81260239

Cancer

OV

Strand

-

Peptide

TGFVAEER

Modified Peptide

n[145]TGFVAEER

Peptide Length

8

ORF Length

129

Open Reading Frame (ORF)

LYSIKRTGFVAEERKHYTVYPPQHQVFTWTQMCDIGGVEVVILGQDPYHRPYQAHEAALVSKGLCDLCLVWKTCMKSCLQTDGFDHPGHGDLSGWAKQGVLFTVFTVQSHQANSPERGWEHLPMQLCPG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.628996

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7448

PhyloCSF Frame 3

0

CNTI Score

-0.40190321