McDonnell Genome Institute

Washington University

Transcript

lnc-STON1-GTF2A1L-5:1

Chromosome

chr2

Gene Name

lnc-STON1-GTF2A1L-5

Start

48809339

CPC Label

noncoding

End

49419013

Cancer

OSCC

Strand

+

Peptide

LHFPVSFLASCGFVTK

Modified Peptide

n[145]LHFPVSFLASCGFVTK

Peptide Length

16

ORF Length

125

Open Reading Frame (ORF)

LHFPVSFLASCGFVTKSWPVGYKQKCFVAAFRKFRQKKALMCPFYSSFLHPAGCNVDMMAGAAVTFWNYEVTLRKEAVTSRMTREMEACFLKGSQKAAIFVWRVLSDTASGTTLMKVESSTYLKL

Conservation Score

0.998

PhyloCSF Frame 1

-4.42

No. of Spectra

1

CPC Coding Probability

0.0841075

PhyloCSF Frame 2 

-4.401

CNTI Index

noncoding

Max Probability

0.0537

PhyloCSF Frame 3

-4.155

CNTI Score

-0.396628271