McDonnell Genome Institute

Washington University

Transcript

lnc-STON1-GTF2A1L-4:2

Chromosome

chr2

Gene Name

lnc-STON1-GTF2A1L-4

Start

50620962

CPC Label

noncoding

End

50632993

Cancer

EOGC

Strand

+

Peptide

GKIYIDIMALFLRN

Modified Peptide

n[145]GKIYIDIMALFLRN

Peptide Length

14

ORF Length

38

Open Reading Frame (ORF)

LQFRTSFKNYKDNFVSLVSEISIKGKIYIDIMALFLRN

Conservation Score

0.997

PhyloCSF Frame 1

-5.896

No. of Spectra

1

CPC Coding Probability

0.0263958

PhyloCSF Frame 2 

-5.972

CNTI Index

noncoding

Max Probability

0.2346

PhyloCSF Frame 3

-4.864

CNTI Score

-0.412739368