McDonnell Genome Institute

Washington University

Transcript

lnc-STON1-GTF2A1L-2:1

Chromosome

chr2

Gene Name

lnc-STON1-GTF2A1L-2

Start

48780601

CPC Label

noncoding

End

48780895

Cancer

PRAD

Strand

+

Peptide

RCMSLASPATGHSCSGAGFLGR

Modified Peptide

RCM[147]SLASPATGHSCSGAGFLGR

Peptide Length

22

ORF Length

68

Open Reading Frame (ORF)

LYKGDQLLVMARRCMSLASPATGHSCSGAGFLGRVRDTYEALHIEPFFSPPMLPDVMNPQDSGSSTNK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0581712

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7946

PhyloCSF Frame 3

0

CNTI Score

-0.33403374