McDonnell Genome Institute

Washington University

Transcript

lnc-STON1-1:1

Chromosome

chr2

Gene Name

lnc-STON1-1

Start

48525354

CPC Label

noncoding

End

48560139

Cancer

CCRC

Strand

+

Peptide

LNAACFVCGK

Modified Peptide

n[43]LNAACFVCGK

Peptide Length

10

ORF Length

38

Open Reading Frame (ORF)

LNAACFVCGKELRFRVLNILSGPFSYLSPLKTLKAITW

Conservation Score

0.777

PhyloCSF Frame 1

-5.315

No. of Spectra

45

CPC Coding Probability

0.105039

PhyloCSF Frame 2 

-5.38

CNTI Index

noncoding

Max Probability

0.9936

PhyloCSF Frame 3

-2.244

CNTI Score

-0.323354598