McDonnell Genome Institute

Washington University

Transcript

lnc-STOM-1:1

Chromosome

chr9

Gene Name

lnc-STOM-1

Start

121291436

CPC Label

noncoding

End

121295288

Cancer

OSCC

Strand

-

Peptide

GTLQGELPEK

Modified Peptide

n[145]GTLQGELPEK

Peptide Length

10

ORF Length

66

Open Reading Frame (ORF)

LRRLNETINVRDPWTMPRKGTLQGELPEKDKRGQVRGRGKRQWDPGVPAESLWAGDTKNDQQGEDK

Conservation Score

0.896

PhyloCSF Frame 1

-4.034

No. of Spectra

3

CPC Coding Probability

0.20908

PhyloCSF Frame 2 

-5.133

CNTI Index

noncoding

Max Probability

0.7116

PhyloCSF Frame 3

-4.979

CNTI Score

-0.370070584