McDonnell Genome Institute

Washington University

Transcript

lnc-STN1-2:6

Chromosome

chr10

Gene Name

lnc-STN1-2

Start

103938145

CPC Label

noncoding

End

103967011

Cancer

LUAD

Strand

-

Peptide

RSQDFLEK

Modified Peptide

n[230]RSQDFLEK

Peptide Length

8

ORF Length

43

Open Reading Frame (ORF)

LPFPNKRSQDFLEKWLILRLGQRVYQMTLAHLLLLESKEMLKK

Conservation Score

0.182

PhyloCSF Frame 1

-5.192

No. of Spectra

1

CPC Coding Probability

0.0334934

PhyloCSF Frame 2 

-4.715

CNTI Index

noncoding

Max Probability

0.1563

PhyloCSF Frame 3

-4.709

CNTI Score

-0.380008234