McDonnell Genome Institute

Washington University

Transcript

lnc-STMP1-4:1

Chromosome

chr7

Gene Name

lnc-STMP1-4

Start

135990720

CPC Label

noncoding

End

135993884

Cancer

HCC

Strand

+

Peptide

EGLSGAFGAETWMRR

Modified Peptide

n[230]EGLSGAFGAETWMRR

Peptide Length

15

ORF Length

47

Open Reading Frame (ORF)

LRDRTVKEGLSGAFGAETWMRRTNLLNALQPEHLRQKKQQLQKPRQV

Conservation Score

0.988

PhyloCSF Frame 1

-3.887

No. of Spectra

16

CPC Coding Probability

0.0289344

PhyloCSF Frame 2 

-5.738

CNTI Index

noncoding

Max Probability

0.7203

PhyloCSF Frame 3

-5.114

CNTI Score

-0.382769975