McDonnell Genome Institute

Washington University

Transcript

lnc-STMN2-1:1

Chromosome

chr8

Gene Name

lnc-STMN2-1

Start

79297716

CPC Label

noncoding

End

79314471

Cancer

OSCC

Strand

+

Peptide

LSFMCCLGLR

Modified Peptide

n[145]LSFMCCLGLR

Peptide Length

10

ORF Length

33

Open Reading Frame (ORF)

MVRLSFMCCLGLRRSGIEIQASWVMRKTEKHFS

Conservation Score

0.26

PhyloCSF Frame 1

-5.262

No. of Spectra

1

CPC Coding Probability

0.0333384

PhyloCSF Frame 2 

-6.162

CNTI Index

noncoding

Max Probability

0.6804

PhyloCSF Frame 3

-5.118

CNTI Score

-0.472452137