McDonnell Genome Institute

Washington University

Transcript

lnc-STK39-1:2

Chromosome

chr2

Gene Name

lnc-STK39-1

Start

168341206

CPC Label

noncoding

End

168344352

Cancer

OV

Strand

-

Peptide

GLFESEEIDILIFVQFHGFYPTPNK

Modified Peptide

n[145]GLFESEEIDILIFVQFHGFYPTPNK

Peptide Length

25

ORF Length

66

Open Reading Frame (ORF)

LIQDTLILKPQCYLFPCPEHPDTILVRNRRKEREYNVKGLFESEEIDILIFVQFHGFYPTPNKKEA

Conservation Score

0.601

PhyloCSF Frame 1

-4.965

No. of Spectra

4

CPC Coding Probability

0.0636932

PhyloCSF Frame 2 

-3.476

CNTI Index

noncoding

Max Probability

0.911

PhyloCSF Frame 3

-2.934

CNTI Score

-0.387879827